SCOPe 2.01: Domain d3i9ab_: 3i9a B:

Lineage for d3i9ab_ (3i9a B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (141 PDB entries)
   Uniprot P02766 31-143

8. Domain d3i9ab_: 3i9a B: [178165]
   automated match to d1eta1_
   complexed with pge

Details for d3i9ab_

PDB Entry: 3i9a, 1.65 Å

PDB Description: crystal structure of human transthyretin variant a25t - #1

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d3i9ab_:

Sequence; same for both SEQRES and ATOM records:

>d3i9ab_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d3i9ab_:

• d3i9ab_ is new in SCOPe 2.01-stable
  
• d3i9ab_ appears in SCOPe 2.02
  
• d3i9ab_ appears in the current release, SCOPe 2.08