SCOPe 2.08: Domain d1afha_: 1afh A:

Lineage for d1afha_ (1afh A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)

6. Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)

7. Species Maize (Zea mays) [TaxId:4577] [47706] (11 PDB entries)

8. Domain d1afha_: 1afh A: [17816]

Details for d1afha_

PDB Entry: 1afh

PDB Description: lipid transfer protein from maize seedlings, nmr, 15 structures

PDB Compounds: (A:) maize nonspecific lipid transfer protein

SCOPe Domain Sequences for d1afha_:

Sequence; same for both SEQRES and ATOM records:

>d1afha_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]}
aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv
sglnagnaasipskcgvsipytiststdcsrvn

Timeline for d1afha_:

• d1afha_ first appeared (with stable ids) in SCOP 1.55, called d1afh__
  
• d1afha_ appears in SCOPe 2.07