![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
![]() | Protein automated matches [190377] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187224] (7 PDB entries) |
![]() | Domain d3i97b_: 3i97 B: [178157] automated match to d1kexa_ complexed with 8dr, gol |
PDB Entry: 3i97 (more details), 2.9 Å
SCOPe Domain Sequences for d3i97b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i97b_ b.18.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kcmealgmesgeihsdqitassqystnwsaersrlnypengwtpgedsyrewiqvdlgll rfvtavgtqgaisketkkkyyvktykidvssngedwitikegnkpvlfqgntnptdvvva vfpkplitrfvrikpatwetgismrfevygckit
Timeline for d3i97b_: