![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
![]() | Protein automated matches [191035] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188859] (14 PDB entries) |
![]() | Domain d3i91b_: 3i91 B: [178154] automated match to d2dnva1 |
PDB Entry: 3i91 (more details), 1.55 Å
SCOPe Domain Sequences for d3i91b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i91b_ b.34.13.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rvfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafeer
Timeline for d3i91b_: