SCOPe 2.08: Domain d3i91b_: 3i91 B:

Lineage for d3i91b_ (3i91 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188859] (14 PDB entries)

8. Domain d3i91b_: 3i91 B: [178154]
   automated match to d2dnva1

Details for d3i91b_

PDB Entry: 3i91, 1.55 Å

PDB Description: crystal structure of human chromobox homolog 8 (cbx8) with h3k9 peptide

PDB Compounds: (B:) Chromobox protein homolog 8

SCOPe Domain Sequences for d3i91b_:

Sequence; same for both SEQRES and ATOM records:

>d3i91b_ b.34.13.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafeer

Timeline for d3i91b_:

• d3i91b_ first appeared in SCOPe 2.01
  
• d3i91b_ appears in SCOPe 2.07