Lineage for d3i90b_ (3i90 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394676Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2394753Protein automated matches [191035] (3 species)
    not a true protein
  7. 2394754Species Human (Homo sapiens) [TaxId:9606] [188859] (14 PDB entries)
  8. 2394772Domain d3i90b_: 3i90 B: [178152]
    automated match to d2dnva1

Details for d3i90b_

PDB Entry: 3i90 (more details), 2 Å

PDB Description: crystal structure of human chromobox homolog 6 (cbx6) with h3k27 peptide
PDB Compounds: (B:) Chromobox protein homolog 6

SCOPe Domain Sequences for d3i90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i90b_ b.34.13.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeq

SCOPe Domain Coordinates for d3i90b_:

Click to download the PDB-style file with coordinates for d3i90b_.
(The format of our PDB-style files is described here.)

Timeline for d3i90b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3i90a_