SCOPe 2.07: Domain d1mzma_: 1mzm A:

Lineage for d1mzma_ (1mzm A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)

6. Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)

7. Species Maize (Zea mays) [TaxId:4577] [47706] (11 PDB entries)

8. Domain d1mzma_: 1mzm A: [17814]
   complexed with fmt, plm

Details for d1mzma_

PDB Entry: 1mzm, 1.78 Å

PDB Description: maize nonspecific lipid transfer protein complexed with palmitate

PDB Compounds: (A:) maize nonspecific lipid transfer protein

SCOPe Domain Sequences for d1mzma_:

Sequence; same for both SEQRES and ATOM records:

>d1mzma_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]}
aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv
sglnagnaasipskcgvsipytiststdcsrvn

Timeline for d1mzma_:

• d1mzma_ first appeared (with stable ids) in SCOP 1.55, called d1mzm__
  
• d1mzma_ appears in SCOPe 2.06
  
• d1mzma_ appears in the current release, SCOPe 2.08