Lineage for d1mzm__ (1mzm -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) 
Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (2 proteins) Protein Plant non-specific lipid-transfer protein (ns-LTP) [47703] (4 species) 
Species Maize (Zea mays) [TaxId:4577] [47706] (3 PDB entries) 
Domain d1mzm__: 1mzm - [17814]
Details for d1mzm__
PDB Entry: 1mzm (more details), 1.78 Å
PDB Description: maize nonspecific lipid transfer protein complexed with palmitate
SCOP Domain Sequences for d1mzm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzm__ a.52.1.1 (-) Plant non-specific lipid-transfer protein (ns-LTP) {Maize (Zea mays)}
aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv
sglnagnaasipskcgvsipytiststdcsrvn
SCOP Domain Coordinates for d1mzm__:
Click to download the PDB-style file with coordinates for d1mzm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mzm__:
- d1mzm__ appears in SCOP 1.57
- d1mzm__ appears in the current release, SCOPe 2.08, called d1mzma_
View in 3D