| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
| Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
| Protein automated matches [190061] (4 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries) |
| Domain d3i7wa_: 3i7w A: [178139] automated match to d1a2wa_ complexed with cl |
PDB Entry: 3i7w (more details), 2.35 Å
SCOPe Domain Sequences for d3i7wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i7wa_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv
Timeline for d3i7wa_: