Lineage for d3i7wa_ (3i7w A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1015692Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1015693Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1015694Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1015999Protein automated matches [190061] (4 species)
    not a true protein
  7. 1016000Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries)
  8. 1016112Domain d3i7wa_: 3i7w A: [178139]
    automated match to d1a2wa_
    complexed with cl

Details for d3i7wa_

PDB Entry: 3i7w (more details), 2.35 Å

PDB Description: high pressure structure of wild-type rnase a (0.67 gpa)
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d3i7wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i7wa_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d3i7wa_:

Click to download the PDB-style file with coordinates for d3i7wa_.
(The format of our PDB-style files is described here.)

Timeline for d3i7wa_: