Lineage for d3i7qa_ (3i7q A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443158Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2443197Species Escherichia coli [TaxId:562] [51575] (17 PDB entries)
  8. 2443202Domain d3i7qa_: 3i7q A: [178133]
    automated match to d1dhpa_
    complexed with gol, k, po4; mutant

Details for d3i7qa_

PDB Entry: 3i7q (more details), 2 Å

PDB Description: dihydrodipicolinate synthase mutant - k161a
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3i7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i7qa_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigireatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOPe Domain Coordinates for d3i7qa_:

Click to download the PDB-style file with coordinates for d3i7qa_.
(The format of our PDB-style files is described here.)

Timeline for d3i7qa_: