Lineage for d1jtb__ (1jtb -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4068Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
  4. 4069Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) (S)
  5. 4070Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (2 proteins)
  6. 4071Protein Plant non-specific lipid-transfer protein (ns-LTP) [47703] (4 species)
  7. 4072Species Barley (Hordeum vulgare) [TaxId:4513] [47705] (3 PDB entries)
  8. 4075Domain d1jtb__: 1jtb - [17813]

Details for d1jtb__

PDB Entry: 1jtb (more details)

PDB Description: lipid transfer protein complexed with palmitoyl coenzyme a, nmr, 16 structures

SCOP Domain Sequences for d1jtb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtb__ a.52.1.1 (-) Plant non-specific lipid-transfer protein (ns-LTP) {Barley (Hordeum vulgare)}
lncgqvdskmkpcltyvqggpgpsgeccngvrdlhnqaqssgdrqtvcnclkgiargihn
lnlnnaasipskcnvnvpytispdidcsriy

SCOP Domain Coordinates for d1jtb__:

Click to download the PDB-style file with coordinates for d1jtb__.
(The format of our PDB-style files is described here.)

Timeline for d1jtb__: