SCOPe 2.01: Domain d3i7ea_: 3i7e A:

Lineage for d3i7ea_ (3i7e A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (5 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (378 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3i7ea_: 3i7e A: [178127]
   automated match to d1kzka_
   complexed with djr; mutant

Details for d3i7ea_

PDB Entry: 3i7e, 1.7 Å

PDB Description: Co-crystal structure of HIV-1 protease bound to a mutant resistant inhibitor UIC-98038

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d3i7ea_:

Sequence; same for both SEQRES and ATOM records:

>d3i7ea_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3i7ea_:

• d3i7ea_ is new in SCOPe 2.01-stable
  
• d3i7ea_ appears in SCOPe 2.02
  
• d3i7ea_ appears in the current release, SCOPe 2.08