Lineage for d3i77a_ (3i77 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404159Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2404344Protein Trypsin [50504] (1 species)
  7. 2404345Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (7 PDB entries)
  8. 2404351Domain d3i77a_: 3i77 A: [178126]
    automated match to d1os8a_
    complexed with act, ca, so4

Details for d3i77a_

PDB Entry: 3i77 (more details), 2.1 Å

PDB Description: 35/99/170-loops of FXa in SGT
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d3i77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i77a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]}
vvggtraaqgefpfmvrlineenegfcggalyaqdivltaahcvsgsgnntsitatggvv
dlqsssavkvrstkvlqapgftketygkdwaliklaqpinqptlkiatttaynqgtftva
gwganreggsqqryllkanvpfvsdaacrssssfilvanemicagypdtggvdtcqgdsg
gpmfrkdnadewiqvgivswgygcarpgypgvytevstfasaiasaartl

SCOPe Domain Coordinates for d3i77a_:

Click to download the PDB-style file with coordinates for d3i77a_.
(The format of our PDB-style files is described here.)

Timeline for d3i77a_: