![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (20 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [188499] (3 PDB entries) |
![]() | Domain d3i76c_: 3i76 C: [178125] automated match to d2gfha1 complexed with cl, gol, mg |
PDB Entry: 3i76 (more details), 2 Å
SCOPe Domain Sequences for d3i76c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i76c_ c.108.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} kryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegkm trdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyiv tngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliigd sltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilni
Timeline for d3i76c_: