SCOPe 2.01: Domain d3i76c_: 3i76 C:

Lineage for d3i76c_ (3i76 C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (20 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188499] (3 PDB entries)

8. Domain d3i76c_: 3i76 C: [178125]
   automated match to d2gfha1
   complexed with cl, gol, mg

Details for d3i76c_

PDB Entry: 3i76, 2 Å

PDB Description: the crystal structure of the orthorhombic form of the putative had- hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement

PDB Compounds: (C:) Putative HAD-hydrolase yfnB

SCOPe Domain Sequences for d3i76c_:

Sequence; same for both SEQRES and ATOM records:

>d3i76c_ c.108.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
kryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegkm
trdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyiv
tngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliigd
sltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilni

Timeline for d3i76c_:

• d3i76c_ is new in SCOPe 2.01-stable
  
• d3i76c_ appears in SCOPe 2.02
  
• d3i76c_ appears in the current release, SCOPe 2.07