Lineage for d3i76c_ (3i76 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011283Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1011284Protein automated matches [190447] (20 species)
    not a true protein
  7. 1011295Species Bacillus subtilis [TaxId:1423] [188499] (3 PDB entries)
  8. 1011300Domain d3i76c_: 3i76 C: [178125]
    automated match to d2gfha1
    complexed with cl, gol, mg

Details for d3i76c_

PDB Entry: 3i76 (more details), 2 Å

PDB Description: the crystal structure of the orthorhombic form of the putative had- hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
PDB Compounds: (C:) Putative HAD-hydrolase yfnB

SCOPe Domain Sequences for d3i76c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i76c_ c.108.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
kryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegkm
trdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyiv
tngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliigd
sltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilni

SCOPe Domain Coordinates for d3i76c_:

Click to download the PDB-style file with coordinates for d3i76c_.
(The format of our PDB-style files is described here.)

Timeline for d3i76c_: