Lineage for d3i70a_ (3i70 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382696Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2382722Family b.40.3.2: The laminin-binding domain of agrin [63767] (1 protein)
    automatically mapped to Pfam PF03146
  6. 2382723Protein The laminin-binding domain of agrin [63768] (1 species)
  7. 2382724Species Chicken (Gallus gallus) [TaxId:9031] [63769] (4 PDB entries)
    Uniprot Q90685 # ! Fragment
  8. 2382727Domain d3i70a_: 3i70 A: [178122]
    automated match to d1jc7a_

Details for d3i70a_

PDB Entry: 3i70 (more details), 2.3 Å

PDB Description: long-wavelength structure of nta
PDB Compounds: (A:) Agrin

SCOPe Domain Sequences for d3i70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i70a_ b.40.3.2 (A:) The laminin-binding domain of agrin {Chicken (Gallus gallus) [TaxId: 9031]}
cperelqrreeeanvvltgtveeimnvdpvhhtysckvrvwrylkgkdivtheilldggn
kvviggfgdplicdnqvstgdtriffvnpapqymwpahrnelmlnsslmritlrnleeve
hcveehrk

SCOPe Domain Coordinates for d3i70a_:

Click to download the PDB-style file with coordinates for d3i70a_.
(The format of our PDB-style files is described here.)

Timeline for d3i70a_: