Lineage for d1be2__ (1be2 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) 
Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (2 proteins) Protein Plant non-specific lipid-transfer protein (ns-LTP) [47703] (4 species) 
Species Barley (Hordeum vulgare) [TaxId:4513] [47705] (3 PDB entries) 
Domain d1be2__: 1be2 - [17812]
Details for d1be2__
PDB Entry: 1be2 (more details)
PDB Description: lipid transfer protein complexed with palmitate, nmr, 10 structures
SCOP Domain Sequences for d1be2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be2__ a.52.1.1 (-) Plant non-specific lipid-transfer protein (ns-LTP) {Barley (Hordeum vulgare)}
lncgqvdskmkpcltyvqggpgpsgeccngvrdlhnqaqssgdrqtvcnclkgiargihn
lnlnnaasipskcnvnvpytispdidcsriy
SCOP Domain Coordinates for d1be2__:
Click to download the PDB-style file with coordinates for d1be2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1be2__:
- d1be2__ appears in SCOP 1.57
- d1be2__ appears in the current release, SCOPe 2.08, called d1be2a_
View in 3D