SCOPe 2.06: Domain d3i6ha_: 3i6h A:

Lineage for d3i6ha_ (3i6h A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)

8. Domain d3i6ha_: 3i6h A: [178112]
   automated match to d1a2wa_
   complexed with cl

Details for d3i6ha_

PDB Entry: 3i6h, 1.3 Å

PDB Description: ribonuclease a by lb nanotemplate method before high x-ray dose on esrf id14-2 beamline

PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d3i6ha_:

Sequence; same for both SEQRES and ATOM records:

>d3i6ha_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d3i6ha_:

• d3i6ha_ first appeared in SCOPe 2.01
  
• d3i6ha_ appears in SCOPe 2.05
  
• d3i6ha_ appears in SCOPe 2.07
  
• d3i6ha_ appears in the current release, SCOPe 2.08