Lineage for d3i63c_ (3i63 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2542243Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2542265Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 2542266Protein automated matches [190991] (1 species)
    not a true protein
  7. 2542267Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)
  8. 2542270Domain d3i63c_: 3i63 C: [178106]
    Other proteins in same PDB: d3i63a_, d3i63e_
    automated match to d1t0rc_
    complexed with fe, peo

Details for d3i63c_

PDB Entry: 3i63 (more details), 2.09 Å

PDB Description: Peroxide Bound Toluene 4-Monooxygenase
PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d3i63c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i63c_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
afpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelfp
rdmtiaesglnptevidvvfee

SCOPe Domain Coordinates for d3i63c_:

Click to download the PDB-style file with coordinates for d3i63c_.
(The format of our PDB-style files is described here.)

Timeline for d3i63c_: