![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.12: TmoB-like [110814] (2 families) ![]() possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
![]() | Family d.15.12.0: automated matches [191572] (1 protein) not a true family |
![]() | Protein automated matches [190991] (1 species) not a true protein |
![]() | Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries) |
![]() | Domain d3i63c_: 3i63 C: [178106] Other proteins in same PDB: d3i63a_, d3i63e_ automated match to d1t0rc_ complexed with fe, peo |
PDB Entry: 3i63 (more details), 2.09 Å
SCOPe Domain Sequences for d3i63c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i63c_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]} afpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelfp rdmtiaesglnptevidvvfee
Timeline for d3i63c_: