Lineage for d1gh1a_ (1gh1 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4068Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
  4. 4069Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) (S)
  5. 4070Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (2 proteins)
  6. 4071Protein Plant non-specific lipid-transfer protein (ns-LTP) [47703] (4 species)
  7. 4083Species Wheat (Triticum aestivum), L. seeds [TaxId:4565] [47704] (3 PDB entries)
  8. 4087Domain d1gh1a_: 1gh1 A: [17810]

Details for d1gh1a_

PDB Entry: 1gh1 (more details)

PDB Description: nmr structures of wheat nonspecific lipid transfer protein

SCOP Domain Sequences for d1gh1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh1a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP) {Wheat (Triticum aestivum), L. seeds}
idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
lnednarsippkcgvnlpytislnidcsrv

SCOP Domain Coordinates for d1gh1a_:

Click to download the PDB-style file with coordinates for d1gh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1gh1a_: