Lineage for d1gh1a_ (1gh1 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323688Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2323689Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2323690Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2323698Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 2323727Species Wheat (Triticum aestivum), L. seeds [TaxId:4565] [47704] (3 PDB entries)
  8. 2323730Domain d1gh1a_: 1gh1 A: [17810]

Details for d1gh1a_

PDB Entry: 1gh1 (more details)

PDB Description: nmr structures of wheat nonspecific lipid transfer protein
PDB Compounds: (A:) nonspecific lipid transfer protein

SCOPe Domain Sequences for d1gh1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh1a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Wheat (Triticum aestivum), L. seeds [TaxId: 4565]}
idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
lnednarsippkcgvnlpytislnidcsrv

SCOPe Domain Coordinates for d1gh1a_:

Click to download the PDB-style file with coordinates for d1gh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1gh1a_: