SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3i5jc_ (3i5j C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160960Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2160982Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 2160983Protein automated matches [190991] (1 species)
    not a true protein
  7. 2160984Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)
  8. 2160995Domain d3i5jc_: 3i5j C: [178097]
    Other proteins in same PDB: d3i5ja_, d3i5je_
    automated match to d1t0rc_
    complexed with fe

Details for d3i5jc_

PDB Entry: 3i5j (more details), 1.9 Å

PDB Description: Diferric Resting State Toluene 4-Monooxygenase HD complex
PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d3i5jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i5jc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

SCOPe Domain Coordinates for d3i5jc_:

Click to download the PDB-style file with coordinates for d3i5jc_.
(The format of our PDB-style files is described here.)

Timeline for d3i5jc_: