Lineage for d3i5gc_ (3i5g C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711371Species Todarodes pacificus [TaxId:6637] [189006] (1 PDB entry)
  8. 2711372Domain d3i5gc_: 3i5g C: [178095]
    Other proteins in same PDB: d3i5gb_
    automated match to d1qviz_
    complexed with ca, mli

Details for d3i5gc_

PDB Entry: 3i5g (more details), 2.6 Å

PDB Description: Crystal structure of rigor-like squid myosin S1
PDB Compounds: (C:) Myosin catalytic light chain LC-1, mantle muscle

SCOPe Domain Sequences for d3i5gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i5gc_ a.39.1.5 (C:) automated matches {Todarodes pacificus [TaxId: 6637]}
sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
dqcndiftfcdiredidgnikyedlmkkvmagpfpd

SCOPe Domain Coordinates for d3i5gc_:

Click to download the PDB-style file with coordinates for d3i5gc_.
(The format of our PDB-style files is described here.)

Timeline for d3i5gc_: