![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein automated matches [190064] (21 species) not a true protein |
![]() | Species Todarodes pacificus [TaxId:6637] [189006] (1 PDB entry) |
![]() | Domain d3i5gc_: 3i5g C: [178095] Other proteins in same PDB: d3i5gb_ automated match to d1qviz_ complexed with ca, mli |
PDB Entry: 3i5g (more details), 2.6 Å
SCOPe Domain Sequences for d3i5gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i5gc_ a.39.1.5 (C:) automated matches {Todarodes pacificus [TaxId: 6637]} sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite dqcndiftfcdiredidgnikyedlmkkvmagpfpd
Timeline for d3i5gc_: