SCOPe 2.07: Domain d3i5gc_: 3i5g C:

Lineage for d3i5gc_ (3i5g C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (22 species)
   not a true protein

7. Species Todarodes pacificus [TaxId:6637] [189006] (1 PDB entry)

8. Domain d3i5gc_: 3i5g C: [178095]
   Other proteins in same PDB: d3i5gb_
   automated match to d1qviz_
   complexed with ca, mli

Details for d3i5gc_

PDB Entry: 3i5g, 2.6 Å

PDB Description: Crystal structure of rigor-like squid myosin S1

PDB Compounds: (C:) Myosin catalytic light chain LC-1, mantle muscle

SCOPe Domain Sequences for d3i5gc_:

Sequence; same for both SEQRES and ATOM records:

>d3i5gc_ a.39.1.5 (C:) automated matches {Todarodes pacificus [TaxId: 6637]}
sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
dqcndiftfcdiredidgnikyedlmkkvmagpfpd

Timeline for d3i5gc_:

• d3i5gc_ first appeared in SCOPe 2.01
  
• d3i5gc_ appears in SCOPe 2.06