Lineage for d3i4wd_ (3i4w D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1786174Protein automated matches [190055] (6 species)
    not a true protein
  7. 1786183Species Human (Homo sapiens) [TaxId:9606] [187785] (42 PDB entries)
  8. 1786198Domain d3i4wd_: 3i4w D: [178093]
    automated match to d1tp3a1
    complexed with act

Details for d3i4wd_

PDB Entry: 3i4w (more details), 1.35 Å

PDB Description: crystal structure of the third pdz domain of psd-95
PDB Compounds: (D:) Disks large homolog 4

SCOPe Domain Sequences for d3i4wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i4wd_ b.36.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqilsvng
vdlrnasheqaaialknagqtvtiiaqykpeeysrfea

SCOPe Domain Coordinates for d3i4wd_:

Click to download the PDB-style file with coordinates for d3i4wd_.
(The format of our PDB-style files is described here.)

Timeline for d3i4wd_: