SCOPe 2.07: Domain d3i4ob_: 3i4o B:

Lineage for d3i4ob_ (3i4o B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
   barrel, closed; n=5, S=8

6. Protein automated matches [190915] (12 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189240] (1 PDB entry)

8. Domain d3i4ob_: 3i4o B: [178089]
   automated match to d1ah9a_

Details for d3i4ob_

PDB Entry: 3i4o, 1.47 Å

PDB Description: crystal structure of translation initiation factor 1 from mycobacterium tuberculosis

PDB Compounds: (B:) Translation initiation factor IF-1

SCOPe Domain Sequences for d3i4ob_:

Sequence; same for both SEQRES and ATOM records:

>d3i4ob_ b.40.4.5 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aievegrvveplpnamfrielenghkvlahisgkmrqhyirilpedrvvvelspydlsrg
rivyryk

Timeline for d3i4ob_:

• d3i4ob_ first appeared in SCOPe 2.01
  
• d3i4ob_ appears in SCOPe 2.06
  
• d3i4ob_ appears in the current release, SCOPe 2.08