Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [190915] (12 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189240] (1 PDB entry) |
Domain d3i4ob_: 3i4o B: [178089] automated match to d1ah9a_ |
PDB Entry: 3i4o (more details), 1.47 Å
SCOPe Domain Sequences for d3i4ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i4ob_ b.40.4.5 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} aievegrvveplpnamfrielenghkvlahisgkmrqhyirilpedrvvvelspydlsrg rivyryk
Timeline for d3i4ob_: