Lineage for d3i4oa_ (3i4o A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 protein domains)
    barrel, closed; n=5, S=8
  6. 2383613Protein automated matches [190915] (10 species)
    not a true protein
  7. 2383619Species Mycobacterium tuberculosis [TaxId:83332] [189240] (1 PDB entry)
  8. 2383620Domain d3i4oa_: 3i4o A: [178088]
    automated match to d1ah9a_

Details for d3i4oa_

PDB Entry: 3i4o (more details), 1.47 Å

PDB Description: crystal structure of translation initiation factor 1 from mycobacterium tuberculosis
PDB Compounds: (A:) Translation initiation factor IF-1

SCOPe Domain Sequences for d3i4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i4oa_ b.40.4.5 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gaievegrvveplpnamfrielenghkvlahisgkmrqhyirilpedrvvvelspydlsr
grivyryk

SCOPe Domain Coordinates for d3i4oa_:

Click to download the PDB-style file with coordinates for d3i4oa_.
(The format of our PDB-style files is described here.)

Timeline for d3i4oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3i4ob_