Lineage for d3i4fc_ (3i4f C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094475Species Bacillus thuringiensis [TaxId:527023] [189003] (1 PDB entry)
  8. 2094478Domain d3i4fc_: 3i4f C: [178086]
    automated match to d1q7ca_

Details for d3i4fc_

PDB Entry: 3i4f (more details), 2.39 Å

PDB Description: structure of putative 3-oxoacyl-reductase from bacillus thuringiensis
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d3i4fc_:

Sequence, based on SEQRES records: (download)

>d3i4fc_ c.2.1.0 (C:) automated matches {Bacillus thuringiensis [TaxId: 527023]}
fvrhalitagtkglgkqvtekllakgysvtvtyhsdttametmketykdveerlqfvqad
vtkkedlhkiveeamshfgkidflinnagpyvferkklvdyeedewnemiqgnltavfhl
lklvvpvmrkqnfgriinygfqgadsapgwiyrsafaaakvglvsltktvayeeaeygit
anmvcpgdiigemkeatiqearqlkehntpigrsgtgediartisflceddsdmitgtii
evtgavdvih

Sequence, based on observed residues (ATOM records): (download)

>d3i4fc_ c.2.1.0 (C:) automated matches {Bacillus thuringiensis [TaxId: 527023]}
fvrhalitagtkglgkqvtekllakgysvtvtyhttametmketykdveerlqfvqadvt
kkedlhkiveeamshfgkidflinnagpyvferkklvdyeedewnemiqgnltavfhllk
lvvpvmrkqnfgriinygfqgadsapgwiyrsafaaakvglvsltktvayeeaeygitan
mvcpgdiigemkeatiqearqlrsgtgediartisflceddsdmitgtiievtgavdvih

SCOPe Domain Coordinates for d3i4fc_:

Click to download the PDB-style file with coordinates for d3i4fc_.
(The format of our PDB-style files is described here.)

Timeline for d3i4fc_: