SCOPe 2.01: Domain d3i47a_: 3i47 A:

Lineage for d3i47a_ (3i47 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (10 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [189004] (1 PDB entry)

8. Domain d3i47a_: 3i47 A: [178080]
   automated match to d1uiya_

Details for d3i47a_

PDB Entry: 3i47, 1.58 Å

PDB Description: crystal structure of putative enoyl coa hydratase/isomerase (crotonase) from legionella pneumophila subsp. pneumophila str. philadelphia 1

PDB Compounds: (A:) Enoyl CoA hydratase/isomerase (Crotonase)

SCOPe Domain Sequences for d3i47a_:

Sequence; same for both SEQRES and ATOM records:

>d3i47a_ c.14.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
slsdllyeiqdkvglltmnriskhnafdnqlltemrirldsaindtnvrvivlkangkhf
sagadltwmqsmanfteeenledslvlgnlmysisqspkptiamvqgaafgggaglaaac
diaiastsarfcfsevklglipavispyvvraigeraakmlfmsaevfdatrayslnlvq
hcvpddtlleftlkyasqisnnapeavknskqlaqyvankkideelvrytasliahkrvs
degqeglkaflnkeipnwn

Timeline for d3i47a_:

• d3i47a_ is new in SCOPe 2.01-stable
  
• d3i47a_ appears in SCOPe 2.02
  
• d3i47a_ appears in the current release, SCOPe 2.08, called d3i47a1