Lineage for d1bwob_ (1bwo B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714862Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2714870Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 2714899Species Wheat (Triticum aestivum), L. seeds [TaxId:4565] [47704] (3 PDB entries)
  8. 2714901Domain d1bwob_: 1bwo B: [17808]
    complexed with lpc

Details for d1bwob_

PDB Entry: 1bwo (more details), 2.1 Å

PDB Description: the crystal structure of wheat non-specific transfer protein complexed with two molecules of phospholipid at 2.1 a resolution
PDB Compounds: (B:) nonspecific lipid-transfer protein

SCOPe Domain Sequences for d1bwob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwob_ a.52.1.1 (B:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Wheat (Triticum aestivum), L. seeds [TaxId: 4565]}
idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
lnednarsippkcgvnlpytislnidcsrv

SCOPe Domain Coordinates for d1bwob_:

Click to download the PDB-style file with coordinates for d1bwob_.
(The format of our PDB-style files is described here.)

Timeline for d1bwob_: