SCOPe 2.07: Domain d1bwob_: 1bwo B:

Lineage for d1bwob_ (1bwo B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)

6. Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)

7. Species Wheat (Triticum aestivum), L. seeds [TaxId:4565] [47704] (3 PDB entries)

8. Domain d1bwob_: 1bwo B: [17808]
   complexed with lpc

Details for d1bwob_

PDB Entry: 1bwo, 2.1 Å

PDB Description: the crystal structure of wheat non-specific transfer protein complexed with two molecules of phospholipid at 2.1 a resolution

PDB Compounds: (B:) nonspecific lipid-transfer protein

SCOPe Domain Sequences for d1bwob_:

Sequence; same for both SEQRES and ATOM records:

>d1bwob_ a.52.1.1 (B:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Wheat (Triticum aestivum), L. seeds [TaxId: 4565]}
idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
lnednarsippkcgvnlpytislnidcsrv

Timeline for d1bwob_:

• d1bwob_ first appeared (with stable ids) in SCOP 1.55
  
• d1bwob_ appears in SCOPe 2.06