SCOPe 2.08: Domain d3i43b_: 3i43 B:

Lineage for d3i43b_ (3i43 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thiol peroxidase Tpx [102452] (4 species)

7. Species Escherichia coli K-12 [TaxId:83333] [189089] (4 PDB entries)

8. Domain d3i43b_: 3i43 B: [178079]
   automated match to d1qxha_
   complexed with cit

Details for d3i43b_

PDB Entry: 3i43, 2.8 Å

PDB Description: Escherichia coli Thiol peroxidase (Tpx) wild type disulfide form

PDB Compounds: (B:) Thiol Peroxidase

SCOPe Domain Sequences for d3i43b_:

Sequence; same for both SEQRES and ATOM records:

>d3i43b_ c.47.1.10 (B:) Thiol peroxidase Tpx {Escherichia coli K-12 [TaxId: 83333]}
sqtvhfqgnpvtvansipqagskaqtftlvakdlsdvtlgqfagkrkvlnifpsidtgvc
aasvrkfnqlateidntvvlcisadlpfaqsrfcgaeglnnvitlstfrnaeflqaygva
iadgplkglaaravvvidendnvifsqlvdeittepdyeaalavlka

Timeline for d3i43b_:

• d3i43b_ first appeared in SCOPe 2.01
  
• d3i43b_ appears in SCOPe 2.07