Lineage for d3i42a1 (3i42 A:19-134)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (73 species)
    not a true protein
  7. 2438857Species Methylobacillus flagellatus [TaxId:265072] [189002] (1 PDB entry)
  8. 2438858Domain d3i42a1: 3i42 A:19-134 [178077]
    Other proteins in same PDB: d3i42a2, d3i42a3
    automated match to d1vlzb_

Details for d3i42a1

PDB Entry: 3i42 (more details), 2.15 Å

PDB Description: structure of response regulator receiver domain (chey-like) from methylobacillus flagellatus
PDB Compounds: (A:) Response regulator receiver domain protein (CheY-like)

SCOPe Domain Sequences for d3i42a1:

Sequence, based on SEQRES records: (download)

>d3i42a1 c.23.1.0 (A:19-134) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
qqalivedyqaaaetfkellemlgfqadyvmsgtdalhamstrgydavfidlnlpdtsgl
alvkqlralpmektskfvavsgfakndlgkeacelfdfylekpidiaslepilqsi

Sequence, based on observed residues (ATOM records): (download)

>d3i42a1 c.23.1.0 (A:19-134) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
qqalivedyqaaaetfkellemlgfqadyvmsgtdalhamstrgydavfidlnlpdtsgl
alvkqlralpmektskfvavsgfkndlgkeacelfdfylekpidiaslepilqsi

SCOPe Domain Coordinates for d3i42a1:

Click to download the PDB-style file with coordinates for d3i42a1.
(The format of our PDB-style files is described here.)

Timeline for d3i42a1: