Lineage for d1bwoa_ (1bwo A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998158Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 1998159Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 1998160Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 protein domains)
  6. 1998168Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 1998197Species Wheat (Triticum aestivum), L. seeds [TaxId:4565] [47704] (3 PDB entries)
  8. 1998198Domain d1bwoa_: 1bwo A: [17807]
    complexed with lpc

Details for d1bwoa_

PDB Entry: 1bwo (more details), 2.1 Å

PDB Description: the crystal structure of wheat non-specific transfer protein complexed with two molecules of phospholipid at 2.1 a resolution
PDB Compounds: (A:) nonspecific lipid-transfer protein

SCOPe Domain Sequences for d1bwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwoa_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Wheat (Triticum aestivum), L. seeds [TaxId: 4565]}
idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
lnednarsippkcgvnlpytislnidcsrv

SCOPe Domain Coordinates for d1bwoa_:

Click to download the PDB-style file with coordinates for d1bwoa_.
(The format of our PDB-style files is described here.)

Timeline for d1bwoa_: