Lineage for d3i3tc_ (3i3t C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634821Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1634822Protein automated matches [190230] (16 species)
    not a true protein
  7. 1634834Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)
  8. 1634866Domain d3i3tc_: 3i3t C: [178068]
    Other proteins in same PDB: d3i3tb_, d3i3td_, d3i3tf_, d3i3th_
    automated match to d2ibia1
    complexed with neh, zn

Details for d3i3tc_

PDB Entry: 3i3t (more details), 2.59 Å

PDB Description: Crystal structure of covalent ubiquitin-USP21 complex
PDB Compounds: (C:) Ubiquitin carboxyl-terminal hydrolase 21

SCOPe Domain Sequences for d3i3tc_:

Sequence, based on SEQRES records: (download)

>d3i3tc_ d.3.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggraqelteafadvigalw
hpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrgrrappilan
gpvpspprrggalleepelsdddranlmwkryleredskivdlfvgqlksclkcqacgyr
sttfevfcdlslpipkkgfaggkvslrdcfnlftkeeelesenapvcdrcrqktrstkkl
tvqrfprilvlhlnrfsasrgsikkssvgvdfplqrlslgdfasdkagspvyqlyalcnh
sgsvhyghytalcrcqtgwhvyndsrvspvsenqvassegyvlfyqlm

Sequence, based on observed residues (ATOM records): (download)

>d3i3tc_ d.3.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hvglrnlgntcflnavlqclsstrplrdfclrrdfrqevqelteafadvigalwhpdsce
avnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrlsdddranlmwkryle
redskivdlfvgqlksclkcqacgyrsttfevfcdlslpipkkgfaggkvslrdcfnlft
keeelesenapvcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsikkssvgvdfpl
qrlslgdfasspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsenqvass
egyvlfyqlm

SCOPe Domain Coordinates for d3i3tc_:

Click to download the PDB-style file with coordinates for d3i3tc_.
(The format of our PDB-style files is described here.)

Timeline for d3i3tc_: