SCOPe 2.02: Domain d3i3qb_: 3i3q B:

Lineage for d3i3qb_ (3i3q B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (3 proteins)

6. Protein automated matches [191077] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189001] (14 PDB entries)

8. Domain d3i3qb_: 3i3q B: [178064]
   automated match to d2fd8a1
   protein/DNA complex; complexed with akg, mn

Details for d3i3qb_

PDB Entry: 3i3q, 1.4 Å

PDB Description: crystal structure of alkb in complex with mn(ii) and 2-oxoglutarate

PDB Compounds: (B:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3i3qb_:

Sequence; same for both SEQRES and ATOM records:

>d3i3qb_ b.82.2.10 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtt
hrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslh
qdkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqp
lkagfhpltidcrynltfrqagk

Timeline for d3i3qb_:

• d3i3qb_ first appeared in SCOPe 2.01
  
• d3i3qb_ appears in SCOPe 2.03
  
• d3i3qb_ appears in the current release, SCOPe 2.08