Lineage for d3i3jl_ (3i3j L:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086488Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1086489Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1086490Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 1086516Protein automated matches [190366] (1 species)
    not a true protein
  7. 1086517Species Human (Homo sapiens) [TaxId:9606] [187201] (9 PDB entries)
  8. 1086544Domain d3i3jl_: 3i3j L: [178061]
    automated match to d1jspb_
    complexed with cl, peg, so4

Details for d3i3jl_

PDB Entry: 3i3j (more details), 2.33 Å

PDB Description: Crystal Structure of the Bromodomain of Human EP300
PDB Compounds: (L:) Histone acetyltransferase p300

SCOPe Domain Sequences for d3i3jl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3jl_ a.29.2.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqsl

SCOPe Domain Coordinates for d3i3jl_:

Click to download the PDB-style file with coordinates for d3i3jl_.
(The format of our PDB-style files is described here.)

Timeline for d3i3jl_: