![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.1: Bromodomain [47371] (6 proteins) |
![]() | Protein automated matches [190366] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries) |
![]() | Domain d3i3jh_: 3i3j H: [178057] automated match to d1jspb_ complexed with cl, peg, so4 |
PDB Entry: 3i3j (more details), 2.33 Å
SCOPe Domain Sequences for d3i3jh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3jh_ a.29.2.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqsl
Timeline for d3i3jh_: