Lineage for d3i3jd_ (3i3j D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267073Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1267074Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 1267103Protein automated matches [190366] (1 species)
    not a true protein
  7. 1267104Species Human (Homo sapiens) [TaxId:9606] [187201] (16 PDB entries)
  8. 1267134Domain d3i3jd_: 3i3j D: [178053]
    automated match to d1jspb_
    complexed with cl, peg, so4

Details for d3i3jd_

PDB Entry: 3i3j (more details), 2.33 Å

PDB Description: Crystal Structure of the Bromodomain of Human EP300
PDB Compounds: (D:) Histone acetyltransferase p300

SCOPe Domain Sequences for d3i3jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3jd_ a.29.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqsl

SCOPe Domain Coordinates for d3i3jd_:

Click to download the PDB-style file with coordinates for d3i3jd_.
(The format of our PDB-style files is described here.)

Timeline for d3i3jd_: