Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.1: Bromodomain [47371] (5 proteins) |
Protein automated matches [190366] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187201] (16 PDB entries) |
Domain d3i3jb_: 3i3j B: [178051] automated match to d1jspb_ complexed with cl, peg, so4 |
PDB Entry: 3i3j (more details), 2.33 Å
SCOPe Domain Sequences for d3i3jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3jb_ a.29.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg
Timeline for d3i3jb_: