Lineage for d3i3jb_ (3i3j B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487719Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 1487750Protein automated matches [190366] (1 species)
    not a true protein
  7. 1487751Species Human (Homo sapiens) [TaxId:9606] [187201] (16 PDB entries)
  8. 1487779Domain d3i3jb_: 3i3j B: [178051]
    automated match to d1jspb_
    complexed with cl, peg, so4

Details for d3i3jb_

PDB Entry: 3i3j (more details), 2.33 Å

PDB Description: Crystal Structure of the Bromodomain of Human EP300
PDB Compounds: (B:) Histone acetyltransferase p300

SCOPe Domain Sequences for d3i3jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3jb_ a.29.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg

SCOPe Domain Coordinates for d3i3jb_:

Click to download the PDB-style file with coordinates for d3i3jb_.
(The format of our PDB-style files is described here.)

Timeline for d3i3jb_: