Lineage for d3i3ha_ (3i3h A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346193Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (9 PDB entries)
    Uniprot Q8AXY1 17-138
  8. 2346205Domain d3i3ha_: 3i3h A: [178047]
    automated match to d1pa0a_

Details for d3i3ha_

PDB Entry: 3i3h (more details), 2.17 Å

PDB Description: Crystal structure of Bothropstoxin-I crystallized at 291K
PDB Compounds: (A:) Phospholipase A2 homolog bothropstoxin-1

SCOPe Domain Sequences for d3i3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3ha_ a.133.1.2 (A:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

SCOPe Domain Coordinates for d3i3ha_:

Click to download the PDB-style file with coordinates for d3i3ha_.
(The format of our PDB-style files is described here.)

Timeline for d3i3ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3i3hb_