SCOPe 2.08: Domain d3i3ha_: 3i3h A:

Lineage for d3i3ha_ (3i3h A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (9 PDB entries)
   Uniprot Q8AXY1 17-138

8. Domain d3i3ha_: 3i3h A: [178047]
   automated match to d1pa0a_

Details for d3i3ha_

PDB Entry: 3i3h, 2.17 Å

PDB Description: Crystal structure of Bothropstoxin-I crystallized at 291K

PDB Compounds: (A:) Phospholipase A2 homolog bothropstoxin-1

SCOPe Domain Sequences for d3i3ha_:

Sequence; same for both SEQRES and ATOM records:

>d3i3ha_ a.133.1.2 (A:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

Timeline for d3i3ha_:

• d3i3ha_ first appeared in SCOPe 2.01
  
• d3i3ha_ appears in SCOPe 2.07