Lineage for d3i3cd_ (3i3c D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055542Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2055586Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2055663Protein automated matches [191035] (3 species)
    not a true protein
  7. 2055664Species Human (Homo sapiens) [TaxId:9606] [188859] (13 PDB entries)
  8. 2055684Domain d3i3cd_: 3i3c D: [178046]
    automated match to d1s4za_
    complexed with na

Details for d3i3cd_

PDB Entry: 3i3c (more details), 2.48 Å

PDB Description: crystal structural of cbx5 chromo shadow domain
PDB Compounds: (D:) Chromobox protein homolog 5

SCOPe Domain Sequences for d3i3cd_:

Sequence, based on SEQRES records: (download)

>d3i3cd_ b.34.13.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diargferglepekiigatdscgdlmflmkwkdtdeadlvlakeanvkcpqiviafyee

Sequence, based on observed residues (ATOM records): (download)

>d3i3cd_ b.34.13.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diargferglepekiigatdsdlmflmkwkdtdeadlvlakeanvkcpqiviafyee

SCOPe Domain Coordinates for d3i3cd_:

Click to download the PDB-style file with coordinates for d3i3cd_.
(The format of our PDB-style files is described here.)

Timeline for d3i3cd_: