SCOPe 2.06: Domain d3i3cb_: 3i3c B:

Lineage for d3i3cb_ (3i3c B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188859] (13 PDB entries)

8. Domain d3i3cb_: 3i3c B: [178044]
   automated match to d1s4za_
   complexed with na

Details for d3i3cb_

PDB Entry: 3i3c, 2.48 Å

PDB Description: crystal structural of cbx5 chromo shadow domain

PDB Compounds: (B:) Chromobox protein homolog 5

SCOPe Domain Sequences for d3i3cb_:

Sequence, based on SEQRES records:

>d3i3cb_ b.34.13.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diargferglepekiigatdscgdlmflmkwkdtdeadlvlakeanvkcpqiviafyeer

Sequence, based on observed residues (ATOM records):

>d3i3cb_ b.34.13.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diargferglepekiigatdsdlmflmkwkdtdeadlvlakeanvkcpqiviafyeer

Timeline for d3i3cb_:

• d3i3cb_ first appeared in SCOPe 2.01
  
• d3i3cb_ appears in SCOPe 2.05
  
• d3i3cb_ appears in SCOPe 2.07
  
• d3i3cb_ appears in the current release, SCOPe 2.08