SCOPe 2.06: Domain d3i3aa_: 3i3a A:

Lineage for d3i3aa_ (3i3a A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (30 species)
   not a true protein

7. Species Leptospira interrogans [TaxId:173] [188993] (3 PDB entries)

8. Domain d3i3aa_: 3i3a A: [178040]
   automated match to d1lxaa_
   complexed with s2n

Details for d3i3aa_

PDB Entry: 3i3a, 2.12 Å

PDB Description: Structural Basis for the Sugar Nucleotide and Acyl Chain Selectivity of Leptospira interrogans LpxA

PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d3i3aa_:

Sequence; same for both SEQRES and ATOM records:

>d3i3aa_ b.81.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 173]}
mkihptaiidpkaelhesvevgpysiiegnvsiqegtiieghvkicagseigkfnrfhqg
avigvmpqdlgfnqqlltktvigdhnifreysnihkgtkedsptvignknyfmgnshvgh
dcilgnnnilthgavlaghvtlgnfafisglvavhqfcfvgdysmvaglakvvqdvppys
tvdgnpstvvglnsvgmkragfspevrnaikhaykviyhsgistrkaldeleasgnlieq
vkyiikffrdsdrgvtnhr

Timeline for d3i3aa_:

• d3i3aa_ first appeared in SCOPe 2.01
  
• d3i3aa_ appears in SCOPe 2.05
  
• d3i3aa_ appears in SCOPe 2.07
  
• d3i3aa_ appears in the current release, SCOPe 2.08