Lineage for d1ocoh_ (1oco H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737085Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1737086Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 1737087Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 1737088Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 1737089Species Cow (Bos taurus) [TaxId:9913] [47697] (10 PDB entries)
  8. 1737107Domain d1ocoh_: 1oco H: [17804]
    Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_
    complexed with cmo, cu, hea, mg, na, zn

Details for d1ocoh_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state
PDB Compounds: (H:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocoh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOPe Domain Coordinates for d1ocoh_:

Click to download the PDB-style file with coordinates for d1ocoh_.
(The format of our PDB-style files is described here.)

Timeline for d1ocoh_: