Lineage for d3i30x_ (3i30 X:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850575Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1850576Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1850577Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1850762Protein automated matches [190073] (13 species)
    not a true protein
  7. 1850865Species Tritirachium album [TaxId:37998] [187258] (13 PDB entries)
  8. 1850870Domain d3i30x_: 3i30 X: [178036]
    automated match to d1bjre_
    complexed with ca

Details for d3i30x_

PDB Entry: 3i30 (more details), 0.99 Å

PDB Description: Proteinase K by Classical hanging drop Method after high X-Ray dose on ID14-2 Beamline at ESRF
PDB Compounds: (X:) Proteinase K

SCOPe Domain Sequences for d3i30x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i30x_ c.41.1.1 (X:) automated matches {Tritirachium album [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d3i30x_:

Click to download the PDB-style file with coordinates for d3i30x_.
(The format of our PDB-style files is described here.)

Timeline for d3i30x_: