Lineage for d3i2zb_ (3i2z B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2383613Protein automated matches [190915] (10 species)
    not a true protein
  7. 2383627Species Salmonella typhimurium [TaxId:90371] [189151] (1 PDB entry)
  8. 2383629Domain d3i2zb_: 3i2z B: [178035]
    Other proteins in same PDB: d3i2za2
    automated match to d1mjca_

Details for d3i2zb_

PDB Entry: 3i2z (more details), 1.1 Å

PDB Description: Structure of cold shock protein E from Salmonella typhimurium
PDB Compounds: (B:) RNA chaperone, negative regulator of cspA transcription

SCOPe Domain Sequences for d3i2zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i2zb_ b.40.4.5 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
kikgnvkwfneskgfgfitpedgskdvfvhfsaiqtngfktlaegqrvefeitngakgps
aanvtal

SCOPe Domain Coordinates for d3i2zb_:

Click to download the PDB-style file with coordinates for d3i2zb_.
(The format of our PDB-style files is described here.)

Timeline for d3i2zb_: