Lineage for d3i2xb1 (3i2x B:4-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792431Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
    automatically mapped to Pfam PF00197
  6. 2792468Protein automated matches [190504] (3 species)
    not a true protein
  7. 2792473Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (12 PDB entries)
  8. 2792490Domain d3i2xb1: 3i2x B:4-180 [178032]
    Other proteins in same PDB: d3i2xa2, d3i2xb2
    automated match to d1wbca_

Details for d3i2xb1

PDB Entry: 3i2x (more details), 2.85 Å

PDB Description: crystal structure of a chimeric trypsin inhibitor having reactive site loop of eti on the scaffold of wci
PDB Compounds: (B:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d3i2xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i2xb1 b.42.4.1 (B:4-180) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssrlrsafiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks

SCOPe Domain Coordinates for d3i2xb1:

Click to download the PDB-style file with coordinates for d3i2xb1.
(The format of our PDB-style files is described here.)

Timeline for d3i2xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3i2xb2