SCOPe 2.08: Domain d3i2xa1: 3i2x A:4-180

Lineage for d3i2xa1 (3i2x A:4-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
   automatically mapped to Pfam PF00197

6. Protein automated matches [190504] (3 species)
   not a true protein

7. Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (12 PDB entries)

8. Domain d3i2xa1: 3i2x A:4-180 [178031]
   Other proteins in same PDB: d3i2xa2, d3i2xb2
   automated match to d1wbca_

Details for d3i2xa1

PDB Entry: 3i2x, 2.85 Å

PDB Description: crystal structure of a chimeric trypsin inhibitor having reactive site loop of eti on the scaffold of wci

PDB Compounds: (A:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d3i2xa1:

Sequence; same for both SEQRES and ATOM records:

>d3i2xa1 b.42.4.1 (A:4-180) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssrlrsafiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks

Timeline for d3i2xa1:

• d3i2xa1 first appeared in SCOPe 2.01, called d3i2xa_
  
• d3i2xa1 appears in SCOPe 2.07