Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins) automatically mapped to Pfam PF00197 |
Protein automated matches [190504] (3 species) not a true protein |
Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (12 PDB entries) |
Domain d3i2xa1: 3i2x A:4-180 [178031] Other proteins in same PDB: d3i2xa2, d3i2xb2 automated match to d1wbca_ |
PDB Entry: 3i2x (more details), 2.85 Å
SCOPe Domain Sequences for d3i2xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i2xa1 b.42.4.1 (A:4-180) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]} dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri ssrlrsafiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks
Timeline for d3i2xa1: