Lineage for d3i2oa_ (3i2o A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2425188Family b.82.2.10: AlkB-like [141628] (3 proteins)
    automatically mapped to Pfam PF13532
  6. 2425205Protein automated matches [191077] (2 species)
    not a true protein
  7. 2425206Species Escherichia coli K-12 [TaxId:83333] [189001] (20 PDB entries)
  8. 2425221Domain d3i2oa_: 3i2o A: [178030]
    automated match to d2fd8a1
    protein/DNA complex; complexed with akg, fe2

Details for d3i2oa_

PDB Entry: 3i2o (more details), 1.7 Å

PDB Description: crystal structure of alkb in complex with fe(ii), 2-oxoglutarate and methylated trinucleotide t-mea-t
PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3i2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i2oa_ b.82.2.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq
gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk
depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka
gfhpltidcrynltfrqag

SCOPe Domain Coordinates for d3i2oa_:

Click to download the PDB-style file with coordinates for d3i2oa_.
(The format of our PDB-style files is described here.)

Timeline for d3i2oa_: