Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.10: AlkB-like [141628] (3 proteins) automatically mapped to Pfam PF13532 |
Protein automated matches [191077] (2 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189001] (20 PDB entries) |
Domain d3i2oa_: 3i2o A: [178030] automated match to d2fd8a1 protein/DNA complex; complexed with akg, fe2 |
PDB Entry: 3i2o (more details), 1.7 Å
SCOPe Domain Sequences for d3i2oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i2oa_ b.82.2.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka gfhpltidcrynltfrqag
Timeline for d3i2oa_: