Lineage for d3i29b_ (3i29 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126115Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1126522Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 1126523Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
  6. 1126560Protein automated matches [190504] (2 species)
    not a true protein
  7. 1126563Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (9 PDB entries)
  8. 1126571Domain d3i29b_: 3i29 B: [178027]
    Other proteins in same PDB: d3i29a_
    automated match to d1wbca_
    complexed with ca; mutant

Details for d3i29b_

PDB Entry: 3i29 (more details), 2.4 Å

PDB Description: Crystal structure of a binary complex between an mutant trypsin inhibitor with bovine trypsin
PDB Compounds: (B:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d3i29b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i29b_ b.42.4.1 (B:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqyrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllka

SCOPe Domain Coordinates for d3i29b_:

Click to download the PDB-style file with coordinates for d3i29b_.
(The format of our PDB-style files is described here.)

Timeline for d3i29b_: